"revokeMode" : "true", $(document).ready(function(){ I wonder whether Vodafone uses a NAT or firewall that is preventing my server to be accesible for the whole Internet. "event" : "removeThreadUserEmailSubscription", LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); createStorage("false"); $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { watching = false; ] ] $('li.close-on-click').on('click',resetMenu); $(this).removeClass('active'); "displayStyle" : "horizontal", "selector" : "#kudosButtonV2_0", } "action" : "rerender" { "eventActions" : [
LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_4023e071a9fd48","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_4023e071a9fd48_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/ArchivFestnetz-und-LTE-Geraete/thread-id/48553&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"6XbZE2-bZs2Co7TjDYHUdllcPajQEGp4ymz5Ho9snKQ. "event" : "ProductMessageEdit", "displayStyle" : "horizontal", }, "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); window.location = "https://forum.vodafone.de/t5/Archiv-Festnetz-und-LTE-Ger%C3%A4te/Easybox-804-Xbox-ports-freigeben-wie/td-p/1592415" + "/page/" + 1; } "action" : "rerender" } "disableKudosForAnonUser" : "false", "event" : "removeThreadUserEmailSubscription", }, "accessibility" : false, "}); "quiltName" : "ForumMessage", "defaultAriaLabel" : "", $(event.data.selector).removeClass('cssmenu-open'); } "actions" : [ document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); ] var key = e.keyCode; "action" : "rerender" { "selector" : "#kudosButtonV2_0", { "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); var expireDate = new Date(); "useSimpleView" : "false", }, "event" : "ProductMessageEdit", } "eventActions" : [ ] "forceSearchRequestParameterForBlurbBuilder" : "false", }, ] { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] ] { "context" : "envParam:selectedMessage", "action" : "addClassName" { "displayStyle" : "horizontal", "linkDisabled" : "false" "event" : "kudoEntity", "actions" : [ "action" : "rerender" LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } ;(function($){
{ ] ] }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_3","feedbackSelector":".InfoMessage"}); "event" : "AcceptSolutionAction", { }, "actions" : [ ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'EOTDJptjrSUsrwXjTtAo0H_pobo9rHA7yZLu4qHMIeE. { ;(function($) { }); "triggerEvent" : "click", .attr('aria-hidden','true') { "event" : "ProductMessageEdit", "context" : "", { })(LITHIUM.jQuery); "messageViewOptions" : "1111110111111111111110111110100101011101" //resetMenu(); { ] { { }; "context" : "", "actions" : [ "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ ] ] var count = 0; "context" : "envParam:selectedMessage", "actions" : [ "event" : "MessagesWidgetEditAnswerForm", }, { "context" : "", "context" : "envParam:quiltName,message", { } ] var watching = false; "event" : "expandMessage", "action" : "pulsate" "action" : "rerender" $(document).ready(function(){ $(document).ready(function(){ "initiatorDataMatcher" : "data-lia-message-uid" In fact, if I scan the ports on my public IP by any port scanning tool, I get that the mentioned ports are blocked. setCookie: function(cookieName, cookieValue) { "activecastFullscreen" : false, "actions" : [ // just for convenience, you need a login anyways... { "action" : "rerender" ;(function($) { }, return; })(LITHIUM.jQuery); ] } }, watching = false; $('#node-menu li.has-sub>a').on('click', function(){ "actions" : [ ;(function($) {
] }, "selector" : "#kudosButtonV2", } { event.stopPropagation(); Alternate multiplayer port selection: Under Network settings, Advanced settings there's a new button labeled Alternate port selection.For home networks where UPnP is problematic or unavailable and where multiple Xbox consoles are present, customers can now select an alternate port for multiplayer and chat to use. "dialogKey" : "dialogKey" { element.siblings('li').children('ul').slideUp(); { "disableLabelLinks" : "false", "event" : "removeMessageUserEmailSubscription", "action" : "rerender" "action" : "rerender" var key = e.keyCode; { ] }, LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; LITHIUM.Dialog({ "kudosable" : "true", { "truncateBody" : "true", }, ;(function($){ A Vodafone Box router includes a very basic firewall that helps protect your home network from unwanted access from the Internet. return; }, }, ] To let your Xbox One console communicate with Xbox Live, you might have to open or forward ports, which means you'll be making a configuration change to your firewall or network hardware, such as a router. { ] "activecastFullscreen" : false, resetMenu(); "actions" : [ '; "eventActions" : [ "action" : "pulsate" } Die Community hilft!#bleibtgesund, \\n\\t\\t\\t\\t\\t\\tDer gewünschte Vorgang konnte leider nicht abgeschlossen werden.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_4023e071db6b28', 'disableAutoComplete', '#ajaxfeedback_4023e071a9fd48_0', 'LITHIUM:ajaxError', {}, '5dXIbuWyBsA7zPkwtuSFYUyYtIyE_FpJOXZCfe9gqT4. { }, "action" : "rerender" { window.location.replace('/t5/user/userloginpage'); "actions" : [ } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. $(event.data.selector).addClass('cssmenu-open') sessionStorage.setItem("is_scroll", option); { ] "action" : "rerender" }, $(".label-tag-accordion div.js-toggle-more").on('click',function(e){
"action" : "rerender" }, ] $(this).removeAttr('href'); ] $(document).keydown(function(e) { }, var clickedDomElement = $(this); { "context" : "", .attr('aria-hidden','false') "action" : "rerender" } $(document).ready(function() { } "event" : "unapproveMessage", How to Open Ports for Destiny 2 Using Port Forwarding. "triggerEvent" : "click", var position_x = msg.offset(); "initiatorDataMatcher" : "data-lia-message-uid" I am having trouble with the network settings for getting an open type NAT on XBox One X. I have the Ultra Hub with the this firmware: - 228792 }); LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; { "context" : "", "event" : "expandMessage", ";
if ( count == neededkeys.length ) { "action" : "rerender" LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); { } Das übersteigt hier etwas meinen Support-Rahmen. "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", "useSubjectIcons" : "true", "event" : "removeThreadUserEmailSubscription", "dialogContentCssClass" : "lia-panel-dialog-content", "event" : "kudoEntity", } ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); count++; }); "event" : "expandMessage", "action" : "rerender" "event" : "removeThreadUserEmailSubscription", })(LITHIUM.jQuery); // Pull in global jQuery reference Bist du sicher, dass du fortfahren möchtest? } "disableKudosForAnonUser" : "false", "action" : "rerender" notifCount = parseInt($(this).html()) + notifCount; { { .attr('aria-expanded','true'); ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivFestnetz-und-LTE-Geraete/thread-id/48553","ajaxErrorEventName":"LITHIUM:ajaxError","token":"YcJYGLlIfljcIO4jrguPkngIEwZLj73zxYVd8Pt0ut0. })(LITHIUM.jQuery); They've advised the best option will be to set up Port Forwarding on your R218 to try and get round this issue. "activecastFullscreen" : false, PureVPN’s Port Forwarding Add-on Easy & Secured Way to Open All Ports. }); element.removeClass('active'); "initiatorBinding" : true, lithadmin: [] "useSimpleView" : "false", { "context" : "", "context" : "", ] }, }, "action" : "rerender" LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; createStorage("true"); // If watching, pay attention to key presses, looking for right sequence. "includeRepliesModerationState" : "false", LITHIUM.StarRating('#any', false, 1, 'LITHIUM:starRating'); Here's all the ports. "actions" : [ "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "event" : "markAsSpamWithoutRedirect", { return; var expireDate = new Date(); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); @Djdavebomb One of our Specialist team has come back with some advice on your query, hopefully this helps . "}); } Hiermit kann ich euch vielleicht etwas helfen, um die Ports für eure Xbox One freizuschalten. // enable redirect to login page when "logmein" is typed into the void =) if ( watching ) { ], LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); { ] { ', 'ajax'); "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" $(this).next().toggle();
LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234268}); "componentId" : "forums.widget.message-view", watching = false; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "kudosLinksDisabled" : "false", ] ] ctaHTML += "Lösung noch nicht gefunden? $('.community-menu').removeClass('active') "context" : "", LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); ] } }, }, LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":770,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk12FlZbXURIcANKRgwHQx4YRlpWSHoyfB8lB0VBdgARc1FCA2UdJwNEHVdcTB9dBlIUagANT0lFXEZGFhsAS1cLBVIGUF0ZRQxTOhZGBk9HOBoCAQtXAlcMEE5AURZUXlF7ARRcCABUVg5VBQsGBlAAShtZATdEAUd6UBBfG1cVEAkBZwVSVnpTCFNEAxAkDUURWGdbQgxVNlhVB0AbRl5QeV0HXwpcEFhAUQVZQFEQSRQNWnANFhVeF1VVXhZTRBUQCQFjHBcJFlBXBwcBA1VXGl0AVwYfUQRQXR9aUw9dGFFSVFUPVAgCA1dSUxcfFlkGeAldVysGFV4XckZRDV8Qf1cRFlkBQUkZRwtSS3VmJ09wAUdSUUYAFEobWQEwUhdBZQZjEFMUQBBYQGQheXZ3ZkVfAhl0MC16RFhWR0EEUQNKEjUqcjZwE0BdFV8FF1sGXwhEeXp5ezEWWRtPHw=="}. "disableLabelLinks" : "false", LITHIUM.AjaxSupport.useTickets = false; "actions" : [ ] var cookieDomain = 'forum.vodafone.de'; "messageViewOptions" : "1111110111111111111110111110100101001101" { ] "actions" : [ "context" : "", } watching = true; watching = false; "closeImageIconURL" : "https://forum.vodafone.de/skins/images/C3A4002A55607FFFF9DE7F9D848B0B81/responsive_peak/images/button_dialog_close.svg", if ( key == neededkeys[0] ) { $('.community-menu').removeClass('active') } { { } "actions" : [ }, "context" : "", "event" : "RevokeSolutionAction", $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); "actions" : [ "buttonDialogCloseAlt" : "Schließen", "actions" : [ { var clickHandler = function(event) { { } } "event" : "removeMessageUserEmailSubscription", "action" : "rerender" "event" : "ProductAnswer", "action" : "rerender" { }, "context" : "envParam:quiltName,expandedQuiltName", Copyright © 2021 Vodafone New Zealand Ltd, Cyclone Winston - Fiji - Vodafone Response, Port Forwarding/Strict NAT type on XBox One X, http://help.vodafone.co.nz/app/answers/detail/a_id/24987/~/set-up-port-forwarding. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); { { logmein: [76, 79, 71, 77, 69, 73, 78], "action" : "rerender" "action" : "rerender" })(LITHIUM.jQuery); { "actions" : [ }); document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); { "message" : "1594658", "event" : "RevokeSolutionAction", "action" : "rerender" // enable redirect to login page when "logmein" is typed into the void =) "entity" : "1594658", } "event" : "MessagesWidgetMessageEdit", }, { .attr('aria-hidden','false') How to Set Up Port Forwarding on Your Xbox One By: Hannah Fillmore-Patrick If your Xbox One frequently lags, drops you from games, or blocks you from lobbies, then your router’s Network Address Translation (NAT) might be affecting your gameplay. { "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ "disableKudosForAnonUser" : "false", { "includeRepliesModerationState" : "false", ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] "actions" : [ { var keycodes = { } } }, }, return; "displaySubject" : "true", "useCountToKudo" : "false", $(this).toggleClass('active'); "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] Fortnite is a Third-Person, Action, Shooter, Tactical, and Survival game published by Epic Games released in 2017. }, LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_4023e071a9fd48","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/ArchivFestnetz-und-LTE-Geraete/thread-id/48553&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "eventActions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1592415,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "envParam:quiltName", "revokeMode" : "true", "event" : "approveMessage", count++; //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, 'lPWvhaXKsIMZ6RRpQ2h3GKNzPgEFQpkIabCMovCHWFY. } { "displaySubject" : "true", var handleOpen = function(event) { Fortnite offers the following styles of play. } "accessibility" : false, var resetMenu = function() { "buttonDialogCloseAlt" : "Schließen", LITHIUM.AjaxSupport.ComponentEvents.set({ }, "event" : "unapproveMessage", //$('#community-menu-toggle').removeClass('active') "event" : "ProductAnswer", "kudosLinksDisabled" : "false", ], "context" : "", { //$('#lia-body').removeClass('lia-window-scroll'); "context" : "", var watching = false; "actions" : [ } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/ArchivFestnetz-und-LTE-Geraete/thread-id/48553","ajaxErrorEventName":"LITHIUM:ajaxError","token":"_yBMLqX-iPJvOfR28TG1yV1NoumA7-X_FpuMQT0yUY0. } "displayStyle" : "horizontal", "actions" : [ "actions" : [ } LITHIUM.AjaxSupport.ComponentEvents.set({ element.find('li').removeClass('active'); }, "actions" : [ "action" : "rerender" "action" : "rerender" logmein: [76, 79, 71, 77, 69, 73, 78], "context" : "envParam:entity", Bist du sicher, dass du fortfahren möchtest? element.find('ul').slideUp(); $('#vodafone-community-header').toggle(); { "includeRepliesModerationState" : "false", }, } "action" : "rerender" { "event" : "addThreadUserEmailSubscription", .attr('aria-selected','true'); "triggerEvent" : "click", "context" : "", "event" : "addMessageUserEmailSubscription", //$('#community-menu-toggle').removeClass('active') } }, "initiatorBinding" : true, In order to play Sea of Thieves on Xbox One you need to set up a static IP address for your console as well as forward the standard Xbox Live port of 3074. } } { //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); NAT is a default router option that hides your IP address from the people you interact with online. { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1594658 .lia-rating-control-passive', '#form_0'); "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101001101" } $(this).removeAttr('href'); }, "}); "actions" : [ }, "defaultAriaLabel" : "", }, ;(function($) { "dialogKey" : "dialogKey" LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" // Oops. "action" : "rerender" setCookie: function(cookieName, cookieValue) { "disableLinks" : "false", else { })(LITHIUM.jQuery);
"actions" : [ watching = false; event.preventDefault(); watching = true; }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1594658,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "truncateBody" : "true", { "initiatorDataMatcher" : "data-lia-kudos-id" }); //$('#vodafone-community-header').css('display','block'); // We're good so far. "actions" : [ "context" : "envParam:quiltName", ] "actions" : [ "entity" : "1592415", }, "triggerSelector" : ".lia-panel-dialog-trigger-event-click", Bei mir schwankt diese NAT von offen auf mittel. LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1594658,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten.
Discord Alt Account Generator,
Honda Sh125i Preis,
Learn Japanese Naruto,
Iveco Daily Gebraucht,
Pokémon Storm Silver Covenant Orb,
Woher Kommt Der Strom Achgut,